Skip to main content

Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16576

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16576-100ul
NBP3-16576-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3T5W8 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Muscarinic Acetylcholine Receptor M2/CHRM2 (P08172). LALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) (NBP3-16576) is a recombinant monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8)

Western Blot: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [NBP3-16576]

Western Blot: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [NBP3-16576]

Western Blot: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [NBP3-16576] - Western blot analysis of extracts of various cell lines, using Muscarinic AChR M2 (Muscarinic Acetylcholine Receptor M2/CHRM2) Rabbit mAb (NBP3-16576) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8)

Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [NBP3-16576] -

Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [NBP3-16576] - Analysis of paraffin-embedded Human esophageal cancer using Muscarinic AChR M2 (Muscarinic AChR M2 (ACM2)) Rabbit mAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8)

Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [NBP3-16576] -

Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [NBP3-16576] - Human tonsil tissue using Muscarinic AChR M2 (ACM2) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CHRM2

Acetylcholine receptors (AChRs) mediate synaptic transmission at the neuromuscular junction. The channel-linked AChR that mediates rapid, excitatory actions of acetylcholine is called nicotinic AChR (nAChR) because it can be activated by nicotine. The non-channel linked AChR that medicates the slow actions of acetylcholine, which can be either inhibitory or excitatory, is called muscarinic AChR (mAChR) because it can be activated by muscarine. The mAChRs are present in neurons of the central and peripheral nervous systems, cardiac and smooth muscle and various exocrine glands. There are 5 subtypes (m1-m5) of the receptor that have a tissue specific pattern of expression. The m2 receptor is localized primarily in cardiac tissue and is also expressed at low levels in the hippocampus, cortex, striatum, thalamus, basal forebrain, brainstem, lung, vas deferens and uterus.

Long Name

Cholinergic Receptor Muscarinic 2

Alternate Names

HM2, mAChR M2

Gene Symbol

CHRM2

Additional CHRM2 Products

Product Documents for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...