Skip to main content

MGAT2 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-58625

Catalog #
Size / Price

Key Product Details

Species Reactivity



Immunocytochemistry/ Immunofluorescence



Antibody Source

Polyclonal Rabbit IgG


Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for MGAT2 Antibody


This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWER

Predicted Species

Mouse (99%), Rat (97%). Backed by our 100% Guarantee.







Scientific Data Images for MGAT2 Antibody

Immunocytochemistry/Immunofluorescence: MGAT2 Antibody [NBP2-58625] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.

Applications for MGAT2 Antibody

Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage


Affinity purified


PBS (pH 7.2) and 40% Glycerol


0.02% Sodium Azide


Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.


The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: N-Acetylglucosaminyltransferase 2/MGAT2

The product of the MGAT2 gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complexN-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, ahydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in this gene may lead tocarbohydrate-deficient glycoprotein syndrome, type II. The coding region of this gene is intronless. Transcriptvariants with a spliced 5' UTR may exist, but their biological validity has not been determined. (provided byRefSeq)

Long Name

Mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase

Alternate Names


Gene Symbol


Additional N-Acetylglucosaminyltransferase 2/MGAT2 Products

Product Documents for MGAT2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MGAT2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
