Skip to main content

MGAT2 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-14235

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-14235
NBP2-14235-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for MGAT2 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: PSVAVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSH

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MGAT2 Antibody

Western Blot: MGAT2 Antibody [NBP2-14235] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: MGAT2 Antibody [NBP2-14235] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Applications for MGAT2 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: N-Acetylglucosaminyltransferase 2/MGAT2

The product of the MGAT2 gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complexN-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, ahydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in this gene may lead tocarbohydrate-deficient glycoprotein syndrome, type II. The coding region of this gene is intronless. Transcriptvariants with a spliced 5' UTR may exist, but their biological validity has not been determined. (provided byRefSeq)

Long Name

Mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase

Alternate Names

CDG2A, GlcNAc-T II, GNT2

Gene Symbol

MGAT2

Additional N-Acetylglucosaminyltransferase 2/MGAT2 Products

Product Documents for MGAT2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MGAT2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...