Skip to main content

MED14 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-83187

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-83187-0.1ml

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human

Applications

Chromatin Immunoprecipitation (ChIP), Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MED14. Peptide sequence: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit MED14 Antibody - BSA Free (NBP2-83187) is a polyclonal antibody validated for use in WB and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for MED14 Antibody - BSA Free

Western Blot: MED14 Antibody [NBP2-83187]

Western Blot: MED14 Antibody [NBP2-83187]

Western Blot: MED14 Antibody [NBP2-83187] - WB Suggested Anti-MED14 Antibody Titration: 0.2-1 ug/ml. Positive Control: A549 cell lysateMED14 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells
Chromatin Immunoprecipitation: MED14 Antibody [NBP2-83187] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Applications for MED14 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MED14

The activation of gene transcription is a multi-step process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multi-subunit complexes e.g. thyroid hormone receptor (TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.

Alternate Names

Activator-recruited cofactor 150 kDa component, ARC150, Cofactor required for Sp1 transcriptional activation subunit 2, cofactor required for Sp1 transcriptional activation, subunit 2 (150kD), CRSP150, CRSP2cofactor required for Sp1 transcriptional activation, subunit 2, 150kDa, CSRP, CXorf4MGC104513, EXLM1CRSP complex subunit 2, human homolog of yeast RGR1, mediator complex subunit 14DRIP150, mediator of RNA polymerase II transcription subunit 14, RGR1RGR1 homolog, Thyroid hormone receptor-associated protein complex 170 kDa component, thyroid hormone receptor-associated protein complex component TRAP170, Transcriptional coactivator CRSP150, transcriptional co-activator CRSP150, Trap170, TRAP170hRGR1, vitamin D receptor-interacting protein complex component DRIP150, Vitamin D3 receptor-interacting protein complex 150 kDa component

Gene Symbol

MED14

Additional MED14 Products

Product Documents for MED14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MED14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...