Laminin beta 1 Antibody (6I9T4)
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16392
Recombinant Monoclonal Antibody
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 6I9T4 expressed in HEK293
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1687-1786 of human Laminin beta 1 (P07942). KKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
198 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Laminin beta 1 Antibody (6I9T4)
Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]
Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Western blot analysis of extracts of Rat lung, using Laminin beta 1 Rabbit mAb (NBP3-16392) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]
Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Western blot analysis of extracts of Mouse heart, using Laminin beta 1 Rabbit mAb (NBP3-16392) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]
Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Western blot analysis of extracts of HepG2 cells, using Laminin beta 1 Rabbit mAb (NBP3-16392) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.Applications for Laminin beta 1 Antibody (6I9T4)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL.
Immunocytochemistry/ Immunofluorescence
1:200 - 1:800
Western Blot
1:1000 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Laminin beta 1
Alternate Names
CLM, cutis laxa with marfanoid phenotype, Laminin B1 chain, laminin subunit beta-1, laminin, beta 1, Laminin-1 subunit beta, Laminin-10 subunit beta, Laminin-12 subunit beta, Laminin-2 subunit beta, Laminin-6 subunit beta, Laminin-8 subunit beta, MGC142015
Gene Symbol
LAMB1
Additional Laminin beta 1 Products
Product Documents for Laminin beta 1 Antibody (6I9T4)
Product Specific Notices for Laminin beta 1 Antibody (6I9T4)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...