Skip to main content

KDELR2 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85141

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-85141-0.1ml

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human KDELR2. Peptide sequence: PVGGLSFLVNHDFSPLEYSRERSSVCQHKCQRPSPASVLQGARTEFLPQQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KDELR2 Antibody - BSA Free

Western Blot: KDELR2 Antibody [NBP2-85141]

Western Blot: KDELR2 Antibody [NBP2-85141]

Western Blot: KDELR2 Antibody [NBP2-85141] - Host: Rabbit. Target Name: KDELR2. Sample Type: RPMI-8226 Whole Cell lysates. Antibody Dilution: 1.0ug/ml
KDELR2 Antibody - BSA Free

Knockdown Validated: KDELR2 Antibody - BSA Free [NBP2-85141] -

Functional Characterization of KDELR2 in Pancreatic Cancer. (A) Western blot analysis and quantification of KDELR2 protein to verify KDELR2 overexpression or knockdown efficiency in PANC-1 cells. (B) Representative images of PANC-1 cells from the sphere formation assay, taken on day 15 after initiation of sphere culture following KDELR2 overexpression or knockdown. (C) Quantify the number of cells within each sphere. (D) Cell migration was assessed using a wound healing assay in KDELR2-overexpressing and KDELR2-knockdown PANC-1 cells, with wound closure observed 24 h post-scratch. (E) Transwell assay was used to assess the invasive ability of PANC-1 cells that overexpressed or knocked down KDELR2. All experiments were independently repeated three times. **P < 0.01 Image collected and cropped by CiteAb from the following open publication (https://link.springer.com/10.1007/s12672-025-03975-1), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for KDELR2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KDELR2

Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognizes, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, which is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the KDEL receptor gene family, have been described. The protein encoded by this gene was the first member of the family to be identified, and it encodes a protein structurally and functionally similar to the yeast ERD2 gene product.

Alternate Names

ELP-1(Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2, ER lumen protein retaining receptor 2, ERD2.2FLJ45532, ERD-2-like protein, ERD2-like protein 1, KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2, KDEL endoplasmic reticulum protein retention receptor 2, KDEL receptor 2

Gene Symbol

KDELR2

Additional KDELR2 Products

Product Documents for KDELR2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for KDELR2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...