Integrin alpha V/CD51 Antibody (10T9N2)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15647

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15647-100ul
NBP3-15647-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10T9N2 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Integrin alpha V/CD51 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human Integrin alpha V/CD51 (NP_002201.2). SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

116 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Integrin alpha V/CD51 Antibody (10T9N2) (NBP3-15647) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Integrin alpha V/CD51 Antibody (10T9N2)

Western Blot: Integrin alpha V/CD51 Antibody (10T9N2) [NBP3-15647]

Western Blot: Integrin alpha V/CD51 Antibody (10T9N2) [NBP3-15647]

Western Blot: Integrin alpha V/CD51 Antibody (7O8N2) [NBP3-15647] - Analysis of extracts of various cell lines, using Integrin alpha V/CD51 (ITGAV/CD51) antibody (NBP3-15647) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Integrin alpha V/CD51 Antibody (7O8N2)

ICC/IF: Integrin alpha V/CD51 Antibody (7O8N2) [NBP3-15647] -

ICC/IF: Integrin alpha V/CD51 Antibody (7O8N2) [NBP3-15647] -ITGAV Antibody [NBP3-15647] was used (1:100) for labeling and microscopy analysis of the distribution of ITGAV proteins in SUM159 cells. Validated customer review.
Integrin alpha V/CD51 Antibody (10T9N2)

Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] -

Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Integrin alpha V/CD51 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
View 2 more images

Applications for Integrin alpha V/CD51 Antibody (10T9N2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

Validated from a verified customer review

Immunohistochemistry

1:50 - 1:200

Western Blot

1:1000 - 1:6000

Reviewed Applications

Read 2 reviews rated 4.5 using NBP3-15647 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Integrin alpha V/CD51

Integrin alpha V chain interacts with the integrin beta 3 subunit/CD61 to form the alpha-V-beta-3 heterodimer/vitronectin receptor. It is expressed on endothelial cells, some activated leukocytes, NK cells, macrophages, neutrophils, and platelets. Integrin alpha V also forms heterodimers with the integrin beta 1, beta 5, beta 6, and beta 8 subunits. Alpha-V-beta-3 is an activation dependent receptor for platelet attachment and spreading on vitronectin and other matrix components.

Alternate Names

CD51, ITGAV, MSK8, Vitronectin Receptor alpha, VNRA

Gene Symbol

ITGAV

Additional Integrin alpha V/CD51 Products

Product Documents for Integrin alpha V/CD51 Antibody (10T9N2)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Integrin alpha V/CD51 Antibody (10T9N2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.