HOX11 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84073

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84073-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

View all HOX11 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOX11. Peptide sequence: MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit HOX11 Antibody - BSA Free (NBP2-84073) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for HOX11 Antibody - BSA Free

Western Blot: HOX11 Antibody [NBP2-84073]

Western Blot: HOX11 Antibody [NBP2-84073]

Western Blot: HOX11 Antibody [NBP2-84073] - WB Suggested Anti-TLX1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: 721_B cell lysateTLX1 is supported by BioGPS gene expression data to be expressed in 721_B

Applications for HOX11 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOX11

HOX11, also called homeobox11 or Tcl-3 is located at the 10q24 T-Cell translocation breakpoint region. It encodes a homeobox-domain containing protein, HOX11, containing a glycine and proline-rich amino terminus. HOX11 is required for maintenance of the developing spleen and cell survival. The HOX11protein binds to a specific DNA sequence and localizes to the cell nucleus. It transactivates transcription of a reporter gene linked to a cis-regulatory element, acting as a positive transcription activator. The HOX11 gene is highly expressed in T-ALLs as a result of a t (7:10) (q35;q24) or t(10:14)(q24;qll) translocation. The homeobox gene is deregulated upon translocation into the T-cell receptor locus and activates a specific subset of tumor-associated target genes. HOX 11 gene translocation has been attributed to T-cell leukemia and lymphoid neoplasias.

Alternate Names

homeo box 11 (T-cell lymphoma 3-associated breakpoint), homeo box-11 (T-cell leukemia-3 associated breakpoint, homologous to DrosophilaNotch), Homeobox protein Hox-11, HOX11T-cell leukemia, homeobox 1, Proto-oncogene TCL-3, T-cell leukemia homeobox 1, T-cell leukemia homeobox protein 1, T-cell leukemia/lymphoma protein 3, TCL3MGC163402

Gene Symbol

TLX1

Additional HOX11 Products

Product Documents for HOX11 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HOX11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.