Skip to main content

hnRNP C1 + C2 Antibody (7A10N5)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16725

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16725-100ul
NBP3-16725-20ul

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7A10N5 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 80-170 of human hnRNP C1 + C2 (P07910). LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit hnRNP C1 + C2 Antibody (7A10N5) (NBP3-16725) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for hnRNP C1 + C2 Antibody (7A10N5)

Western Blot: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725]

Western Blot: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725]

Western Blot: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] - Western blot analysis of extracts of various cell lines, using hnRNP C1 + C2 Rabbit mAb (NBP3-16725) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunocytochemistry/ Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725]

Immunocytochemistry/ Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725]

Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] - Immunofluorescence analysis of U-2 OS cells using hnRNP C1 + C2 Rabbit mAb (NBP3-16725) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
hnRNP C1 + C2 Antibody (7A10N5)

Immunocytochemistry/ Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] -

Immunocytochemistry/ Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] - Confocal imaging of U-2 OS cells using hnRNP C1 + C2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for hnRNP C1 + C2 Antibody (7A10N5)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: hnRNP C1 + C2

RNA polymerase II transcripts in the nucleus are in complex with several proteins called heterogeneous nuclear ribonucleoproteins (hnRNPs). These proteins are important in biological activities such as transcription, pre-mRNA processing, cytoplasmic mRNA translation, and turnover. hnRNPs can be isolated either by immunoprecipitation or by sucrose gradient fractionation of cell extracts. When this is performed, the hnRNPs are isolated (consisting of protein groups named A to U), and many of these protein groups consist of more than one isoform. The major steadystate proteins of the isolated hnRNP complex are the A1, A2, B1, B2, C1, and C2 with a range of molecular weight starting with 34 kDa up to 43 kDa. The hnRNP-C proteins have a single RNP motif RNA-binding domain (RBD) of 80 to 100 amino acid long. The hnRNP -C proteins preferentially bind to uridine-rich RNA sequences. Oligomerization of the protein through leucine rich regions in its C-terminal end is important for RNA binding.4 Although its physiological action is unknown, mutation of the hnRNPC gene causes a embryonic lethal phenotype.

Alternate Names

C1, C2, heterogeneous nuclear ribonucleoprotein C (C1/C2), heterogeneous nuclear ribonucleoproteins C1/C2, HNRNP, hnRNP C1/C2, hnRNPC, HNRPC, MGC104306, MGC105117, MGC117353, MGC131677, nuclear ribonucleoprotein particle C1 protein, nuclear ribonucleoprotein particle C2 protein, SNRPC

Gene Symbol

HNRNPC

Additional hnRNP C1 + C2 Products

Product Documents for hnRNP C1 + C2 Antibody (7A10N5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for hnRNP C1 + C2 Antibody (7A10N5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...