HIV-1 Gag p24 Antibody (8G9) - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-41336

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Virus

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 Clone # 8G9

Format

BSA Free

Concentration

1 mg/ml

View all HIV-1 Gag p24 Antibodies »

Product Specifications

Immunogen

Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla

Specificity

By Western blot, anti-HIV-1 Gag p24 antibody detects a ~24 kDa, a ~41 kDa, and a ~55 kDa protein, corresponding to HIV-1 Gag p24 and to its precursors p41 and p55, respectively, in HIV-1 samples.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Theoretical MW

24, 41, 55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Mouse HIV-1 Gag p24 Antibody (8G9) - BSA Free (NBP2-41336) is a monoclonal antibody validated for use in WB and ELISA. Anti-HIV-1 Gag p24 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for HIV-1 Gag p24 Antibody (8G9) - BSA Free

Western Blot: HIV-1 Gag p24 Antibody (8G9)BSA Free [NBP2-41336]

Western Blot: HIV-1 Gag p24 Antibody (8G9)BSA Free [NBP2-41336]

Western Blot: HIV-1 Gag p24 Antibody (8G9) - BSA Free [NBP2-41336] - Western blot analysis of 20 ng of (A) viral p24 and (B) recombinant p24 with anti-HIV-1 Gag p24 antibody NBP2-41336 at (A) 0.5 ug/mL and (B) 0.2 ug/mL, respectively.
ELISA: HIV-1 Gag p24 Antibody (8G9) - BSA Free [NBP2-41336]

ELISA: HIV-1 Gag p24 Antibody (8G9) - BSA Free [NBP2-41336]

ELISA: HIV-1 Gag p24 Antibody (8G9) - BSA Free [NBP2-41336] - Titration ELISA of anti-HIV-1 Gag p24 antibody NBP2-41336 with 100 ng of recombinant HIV-1 Gag p24 protein.

Applications for HIV-1 Gag p24 Antibody (8G9) - BSA Free

Application
Recommended Usage

ELISA

0.2-0.5 ug/ml

Western Blot

0.2-0.5 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HIV-1 Gag p24

The gag gene of human immunodeficiency virus 1 (HIV-1) encodes a precursor protein known as Pr55Gag. The viral protease PR cleaves this precursor to generate p17, p24, p7, and p6 proteins which are required for virus particle assembly. p24 is a major viral core structural protein. Its measurement is commonly used as an indicator of HIV-1 infection and viral load.

Long Name

Human Immunodeficiency Virus Type 1 GAG/Group-specific Antigen core protein of 24 kDa

Alternate Names

CA, Capsid Protein, HIV1 Gag p24, Pr55(Gag)

Gene Symbol

gag

Additional HIV-1 Gag p24 Products

Product Documents for HIV-1 Gag p24 Antibody (8G9) - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for HIV-1 Gag p24 Antibody (8G9) - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.