Histone H3.3 Antibody (5C5B8)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16489

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16489-100ul
NBP3-16489-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Chromatin Immunoprecipitation (ChIP), Chromatin Immunoprecipitation Sequencing

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5C5B8 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Histone H3.3 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 57-136 of human Histone H3.3 (P84243). KSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Reactivity Notes

Wide Range Predicted

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Histone H3.3 Antibody (5C5B8) (NBP3-16489) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Histone H3.3 Antibody (5C5B8)

Western Blot: Histone H3.3 Antibody (5C5B8) [NBP3-16489]

Western Blot: Histone H3.3 Antibody (5C5B8) [NBP3-16489]

Western Blot: Histone H3.3 Antibody (5C5B8) [NBP3-16489] - Western blot analysis of extracts of various cell lines, using Histone H3.3 Rabbit mAb (NBP3-16489) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: Histone H3.3 Antibody (5C5B8) [NBP3-16489]

Western Blot: Histone H3.3 Antibody (5C5B8) [NBP3-16489]

Western Blot: Histone H3.3 Antibody (5C5B8) [NBP3-16489] - Western blot analysis of extracts of Rat lung, using Histone H3.3 Rabbit mAb (NBP3-16489) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: Histone H3.3 Antibody (5C5B8) [NBP3-16489]

Immunohistochemistry-Paraffin: Histone H3.3 Antibody (5C5B8) [NBP3-16489]

Immunohistochemistry-Paraffin: Histone H3.3 Antibody (5C5B8) [NBP3-16489] - Immunohistochemistry of paraffin-embedded rat kidney using Histone H3.3 Rabbit mAb (NBP3-16489) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
View 2 more images

Applications for Histone H3.3 Antibody (5C5B8)

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

2μg antibody for 5μg-10μg of Chromatin

Chromatin Immunoprecipitation Sequencing

1:50 - 1:200

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Histone H3.3

Alternate Names

H3.3A, H3F3, H3F3A, Histone H3.3, Histone H3.3A, Histone H3.3B, MGC87782, MGC87783

Gene Symbol

H3-3A

Additional Histone H3.3 Products

Product Documents for Histone H3.3 Antibody (5C5B8)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Histone H3.3 Antibody (5C5B8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2026 Bio-Techne. All Rights Reserved.