Skip to main content

GnRH Antibody [DyLight 405]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38172V

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP3-38172V has been discontinued. View all GnRH products.

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

DyLight 405 (Excitation = 400 nm, Emission = 420 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 24-92 of human GnRH (NP_001076580.1).

Sequence:
QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for GnRH Antibody [DyLight 405]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: GnRH

Gonadotropin releasing hormone (GnRH), also known as luteinizing hormone releasing hormone (LHRH), is a key molecule in the regulation of reproduction in vertebrates. GnRH, a decapeptide, is produced by neurons in the medial basal hypothalamus (MBH) and secreted in a pulsatile manner into the cardiovascular system. The frequency and amplitude of GnRH pulses determine secretion of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary. Higher frequencies (greater than one pulse per hour) stimulate LH secretion while lower frequencies stimulate FSH secretion. The generation of GnRH pulses is effected by numerous stimuli, such as neural, hormonal and environmental. Therefore, behavioral and physiological conditions such as sleep, exercise, and stress can affect the GnRH pulses and cause a disruption of the normal cycle.Recent studies show that GnRH also has a role in mediating cancer. GnRH has been shown to inhibit the growth of human uterine leiomyloma cells by suppressing proliferation and inducing apoptosis. GnRH analogs have been used to treat a wide variety of reproductive cancers, although the side effects of using such compounds are often quite severe.

Alternate Names

GNRH, GnRH-associated peptide 1, gonadotropin-releasing hormone 1 (leutinizing-releasing hormone), gonadotropin-releasing hormone 1 (luteinizing-releasing hormone), GRH, LHRH, LNRH, luliberin I, Progonadoliberin I, progonadoliberin-1, prolactin release-inhibiting factor

Gene Symbol

Gnrh1

Additional GnRH Products

Product Documents for GnRH Antibody [DyLight 405]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GnRH Antibody [DyLight 405]



DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...