Skip to main content

GDF-9 Antibody (GDF9/4261) [Alexa Fluor® 594]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-08362AF594

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Alexa Fluor 594 (Excitation = 590 nm, Emission = 617 nm)

Antibody Source

Monoclonal Mouse IgG1 Clone # GDF9/4261

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9. (Uniprot: O60383)

Localization

Cytoplasmic (secreted)

Specificity

GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Applications for GDF-9 Antibody (GDF9/4261) [Alexa Fluor® 594]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: GDF-9

GDF9, also known as Growth/differentiation factor 9, is a 454 amino acid that is 51 kDa, is a multifunctional protein required for ovarian folliculogenesis; directly affects oocyte growth and function; stimulates granulosa cell proliferation; promotes primordial follicle development and cell transition from G0/G1 to S; regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells; increases the expression of inhibin B and suppresses FST and FSTL3 production in granulosa-lutein cells. Disease research is currently being studied with relation to GDF9 and polycystic ovary syndrome, premature ovarian failure, blepharophimosis, galactosemia, infertility, gonadal dysgenesis, twinning, prostate cancer, Huntington's disease, endometriosis, prostatitis, breast cancer, and hepatitis B. Interactions with GDF9 protein have been shown to involve SMN1, SMN2, APLP1, GADD45G, TK1, PRKRA and around 50 other interacting proteins in nuclear receptor activation by vitamin-A, paxillin interactions, telomerase components in cell signaling, mitochondrial apoptosis, molecular mechanisms of cancer, antioxidant action of vitamin-C, eIF2 pathway, intracellular calcium signaling, JNK pathway, apoptotic pathways in synovial fibroblasts plus 44 more other pathways.

Long Name

Growth Differentiation Factor 9

Alternate Names

GDF9

Gene Symbol

GDF9

Additional GDF-9 Products

Product Documents for GDF-9 Antibody (GDF9/4261) [Alexa Fluor® 594]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GDF-9 Antibody (GDF9/4261) [Alexa Fluor® 594]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...