Skip to main content

FKBP52/FKBP4 Antibody (3Q6H2)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16387

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16387-100ul
NBP3-16387-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3Q6H2 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human FKBP4 (Q02790). MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit FKBP52/FKBP4 Antibody (3Q6H2) (NBP3-16387) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for FKBP52/FKBP4 Antibody (3Q6H2)

Western Blot: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387]

Western Blot: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387]

Western Blot: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387] - Western blot analysis of extracts of various cell lines, using FKBP52/FKBP4 Rabbit mAb (NBP3-16387) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387]

Immunocytochemistry/ Immunofluorescence: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387]

Immunocytochemistry/Immunofluorescence: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387] - Immunofluorescence analysis of U-2 OS cells using FKBP52/FKBP4 Rabbit mAb (NBP3-16387) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387]

Immunocytochemistry/ Immunofluorescence: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387]

Immunocytochemistry/Immunofluorescence: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387] - Immunofluorescence analysis of NIH-3T3 cells using FKBP52/FKBP4 Rabbit mAb (NBP3-16387) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for FKBP52/FKBP4 Antibody (3Q6H2)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: FKBP52

Hsp90 is crucial to cellular signaling by its regulation of the folding, activity, and stability of a wide range of client proteins. These client protein complexes may also contain one or more cochaperones (1). One class of Hsp90-binding cochaperone is composed of proteins with a characteristic tetratricopeptide repeat (TPR) domain that forms an Hsp90 binding site. Among the TPR cochaperones of Hsp90 are Hop/Sti1, protein phosphatase PP5, and members of both the FK506- and cyclosporin Abinding families of immunophilins (2). FK506-binding protein 51 (FKBP51) and FKBP52 are large molecular weight immunophilins that are part of the mature glucocorticoid receptor (GR) heterocomplex (3). The N terminal domain of each protein binds FK506 and has peptidyl-prolyl isomerase (PPIase) activity that converts prolyl peptide bonds within target proteins from cis- to trans- proline. The C-terminal domains contain the TPR repeats involved in protein-protein interactions with the Hsp90 (4). Although FKBP52 and FKBP51 share approx. 75% sequence similarity, they affect hormone binding by glucocorticoid receptor in opposing manners and have different Hsp90- binding characteristics (3, 5). Also, whereas FKBP51 typically has a role with the progesterone receptor, FKBP52 has been found to be linked to the progesterone, androgen and glucocorticoid receptors (5).

Long Name

52 kDa FK506 Binding Protein

Alternate Names

FKBP4, FKBP59, HBI, Hsp56

Gene Symbol

FKBP4

Additional FKBP52 Products

Product Documents for FKBP52/FKBP4 Antibody (3Q6H2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for FKBP52/FKBP4 Antibody (3Q6H2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...