Skip to main content

Ferroportin/SLC40A1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49454

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-49454
NBP2-49454-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

This Ferroportin/SLC40A1 Antibody was developed against a recombinant protein corresponding to amino acids: VKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYN

Reactivity Notes

Mouse (87%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

62.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Ferroportin/SLC40A1 Antibody - BSA Free (NBP2-49454) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Ferroportin/SLC40A1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Ferroportin/SLC40A1 Antibody [NBP2-49454]

Immunocytochemistry/ Immunofluorescence: Ferroportin/SLC40A1 Antibody [NBP2-49454]

Immunocytochemistry/Immunofluorescence: Ferroportin/SLC40A1 Antibody [NBP2-49454] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Ferroportin/SLC40A1 Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ferroportin/SLC40A1 Antibody [NBP2-49454]

Immunohistochemistry-Paraffin: Ferroportin/SLC40A1 Antibody [NBP2-49454]

Immunohistochemistry-Paraffin: Ferroportin/SLC40A1 Antibody [NBP2-49454] - Staining of human placenta using shows weak to moderate positivity in erythrocytes.
Immunohistochemistry-Paraffin: Ferroportin/SLC40A1 Antibody [NBP2-49454]

Immunohistochemistry-Paraffin: Ferroportin/SLC40A1 Antibody [NBP2-49454]

Immunohistochemistry-Paraffin: Ferroportin/SLC40A1 Antibody [NBP2-49454] - Staining of human duodenum using Ferroportin/SLC40A1 Antibody shows weak cytoplasmic positivity in glandular cells.

Applications for Ferroportin/SLC40A1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ferroportin/SLC40A1

Ferroportin is a 12-transmembrane domain protein, belonging to the major facilitator superfamily of transporters of small molecules, that is localized to the plasma membrane. Human Ferroportin has a theoretical molecular weight of 62.5 kDa. Ferroportin (FPN1 or SLC40A1) functions as an iron-regulated transporter (highly expressed in placenta, intestine, muscle, spleen, macrophages etc.) and is the receptor for the iron-regulatory hormone, hepcidin. In iron metabolism, FPN1 plays a key role in intestinal iron absorption as well as cellular iron release and mediates iron absorption in the presence of ferroxidases, hephaestin (HP) and/or ceruloplasmin (CP). FPN1 is implicated in iron export from duodenal epithelial cells and in the transfer of iron between maternal and fetal circulation. FPN1 transports iron in the ferrous form whereas plasma transferrin only binds iron's ferric form. Ferroxidases are key players in oxidizing iron transported by FPN1 and without the activity of ferroxidases, FPN1 is internalized followed by degradation. While other cell types utilize the circulating or GPI-linked multicopper ferroxidase CP for FPN1, intestinal cells utilize a membrane-bound HP, a paralog of CP that also show interaction with FPN1 (1).

FPN1 regulation is dependent on the cell type and involves transcriptional, posttranscriptional, and posttranslational mechanisms including hepcidin-mediated endocytosis and proteolysis. Hepcidin controls the concentration of FPN1 in the membrane, with hepcidin deficiency resulting in iron overload (high iron) and hepcidin excess leading to iron restriction and anemia (2). Ferroportin disease or hemochromatosis type 4 (HFE4) is associated with distinct FPN1 variants with either reduced FPN1 cell surface expression/iron export capacity or hepcidin resistance and iron overload (3, 4).

References

1. De Domenico I, Ward DM, Kaplan J. (2011) Hepcidin and ferroportin: the new players in iron metabolism. Semin Liver Dis. 31(3):272-9. PMID: 21901657

2. Drakesmith H, Nemeth E, Ganz T. (2015) Ironing out Ferroportin. Cell Metab. 22(5):777-87. PMID: 26437604

3. Pietrangelo A. (2017) Ferroportin disease: pathogenesis, diagnosis and treatment. Haematologica. 102(12):1972-1984. PMID: 29101207

4. Vlasveld LT, Janssen R, Bardou-Jacquet E, Venselaar H, Hamdi-Roze H, Drakesmith H, Swinkels DW. (2019) Twenty Years of Ferroportin Disease: A Review or An Update of Published Clinical, Biochemical, Molecular, and Functional Features. Pharmaceuticals (Basel). 12(3). pii: E132. PMID: 31505869

Long Name

Solute Carrier Family 40 Member 1

Alternate Names

FPN1, HFE4, IREG1, MST079, MTP1, SLC11A3, SLC40A1

Gene Symbol

SLC40A1

Additional Ferroportin/SLC40A1 Products

Product Documents for Ferroportin/SLC40A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Ferroportin/SLC40A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...