Skip to main content

EEN Antibody [Alexa Fluor® 350]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38429AF350

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat, Monkey

Applications

ELISA, Western Blot

Label

Alexa Fluor 350 (Excitation = 346 nm, Emission = 442 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 219-368 of human EEN (NP_003016.1).

Sequence:
VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for EEN Antibody [Alexa Fluor® 350]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: EEN

Endophilin A2 is an SH3 domain containing protein implicated in endocytosis. It has been identified in human acute leukemia as a fusion partner of MLL (mixed-lineage leukemia). Because of its involvement in this chromosomal translocation, endophilin A2 is also known as EEN (extra eleven nineteen).

Alternate Names

CNSA1endophilin-2, EEN fusion partner of MLL, EENSH3 domain-containing GRB2-like protein 1, Endophilin-2, extra 11-19 leukemia fusion, Extra eleven-nineteen leukemia fusion gene protein, MGC111371, SH3 domain protein 2B, SH3-containing Grb-2-like 1 protein, SH3D2Bendophilin-A2, SH3-domain GRB2-like 1, SH3P8

Gene Symbol

SH3GL1

Additional EEN Products

Product Documents for EEN Antibody [Alexa Fluor® 350]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for EEN Antibody [Alexa Fluor® 350]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...