Skip to main content

DNCIC1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38053

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human DNCIC1 (NP_001129028.1).

Sequence:
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DNCIC1 Antibody - BSA Free

DNCIC1 Antibody

Immunohistochemistry: DNCIC1 Antibody [NBP3-38053] -

Immunohistochemistry: DNCIC1 Antibody [NBP3-38053] - Immunohistochemistry analysis of paraffin-embedded Rat brain using DNCIC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
DNCIC1 Antibody

Immunohistochemistry: DNCIC1 Antibody [NBP3-38053] -

Immunohistochemistry: DNCIC1 Antibody [NBP3-38053] - Immunohistochemistry analysis of paraffin-embedded Human stomach using DNCIC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
DNCIC1 Antibody

Western Blot: DNCIC1 Antibody [NBP3-38053] -

Western Blot: DNCIC1 Antibody [NBP3-38053] - Western blot analysis of various lysates using DNCIC1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.

Applications for DNCIC1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:20 - 1:200

Western Blot

1:200 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DNCIC1

Eukaryotic cells rely on actin and microtubule-based protein "motors" to generate intracellular movements.4 These protein "motors" contain specialized domains that hydrolyse ATP to produce force and movement along a cytoskeletal polymer (actin in the case of myosin family and microtubules in the case of the kinesin family and dyneins). The minus-end-directed, microtubule motor, dynein ATPase is one of the most widely studied microtubule-associated energy transducing enzymes. It constitutes the outer and inner arms on the doublet tubules of sperm flagellar axonemes, where it generates the sliding between doublets that underlies flagellar beating. Dynein has also been implicated in cytoplasmic motile functions, including chromosomal movement, retrograde organelle and axonal transport, the endocytic pathway, and the organization of the Golgi apparatus. In all cell types, dynein has the same basic structures and is composed of two or three distinct heavy chains (approximately 450 kDa), three intermediate chains (70-125 kDa), and at least four light chains (15-25 kDa).5

Alternate Names

cytoplasmic dynein 1 intermediate chain 1, Cytoplasmic dynein intermediate chain 1, DNCI1cytoplasmic, intermediate polypeptide 1, DNCIC1DH IC-1, Dynein intermediate chain 1, cytosolic, dynein, cytoplasmic 1, intermediate chain 1

Gene Symbol

DYNC1I1

Additional DNCIC1 Products

Product Documents for DNCIC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DNCIC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...