Skip to main content

Cytokeratin 5 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-92884

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-92884-0.02ml
NBP2-92884-0.1ml

Key Product Details

Species Reactivity

Human, Mouse

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunoprecipitation, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 5 (NP_000415.2). MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGYGSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Cytokeratin 5 Antibody - BSA Free (NBP2-92884) is a polyclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Cytokeratin 5 Antibody - BSA Free

Western Blot: Cytokeratin 5 AntibodyAzide and BSA Free [NBP2-92884]

Western Blot: Cytokeratin 5 AntibodyAzide and BSA Free [NBP2-92884]

Western Blot: Cytokeratin 5 Antibody [NBP2-92884] - Western blot analysis of extracts of various cell lines, using Cytokeratin 5 antibody (NBP2-92884) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Cytokeratin 5 Antibody - Azide and BSA Free [NBP2-92884]

Immunocytochemistry/ Immunofluorescence: Cytokeratin 5 Antibody - Azide and BSA Free [NBP2-92884]

Immunocytochemistry/Immunofluorescence: Cytokeratin 5 Antibody [NBP2-92884] - Immunofluorescence analysis of L929 cells using Cytokeratin 5 Rabbit pAb (NBP2-92884) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Cytokeratin 5 Antibody - Azide and BSA Free [NBP2-92884]

Immunohistochemistry-Paraffin: Cytokeratin 5 Antibody - Azide and BSA Free [NBP2-92884]

Immunohistochemistry-Paraffin: Cytokeratin 5 Antibody [NBP2-92884] - Immunohistochemistry of paraffin-embedded Human esophageal cancer using Cytokeratin 5 Rabbit pAb (NBP2-92884) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for Cytokeratin 5 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cytokeratin 5

Keratins are a family of structurally related proteins that form the intermediate filament cytoskeleton in epithelial cells. The 58-kD keratin CK-5 is highly similar to other type II keratins and less similar to type I keratins and other intermediate filament proteins. The 58-kD keratin is regulated by retinoids in several tissues and is one of four keratins abundantly expressed in epidermal keratinocytes, where it may be important in maintaining structural integrity of the integument (1). Keratin 5 (CK-5) mRNA and protein are shown to be expressed in normal mammary epithelial cells in culture and are absent from tumor-derived cell lines. This makes CK-5 an important marker in the tumorigenic process, distinguishing normal from tumor cells, and decreased CK-5 expression correlates with tumorigenic progression (2). Dowling-Degos disease (DDD) is an autosomal dominant genodermatosis characterized by progressive and disfiguring reticulate hyperpigmentation of the flexures. Loss of function of CK-5 suggests a crucial role for keratins in the organization of cell adhesion, melanosome uptake, organelle transport, and nuclear anchorage (3).

Alternate Names

CK-5, DDD, EBS2, Keratin 5, KRT5

Gene Symbol

KRT5

Additional Cytokeratin 5 Products

Product Documents for Cytokeratin 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Cytokeratin 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov