Skip to main content

beta I + II Tubulin Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-83947

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP2-83947 has been discontinued. View all beta I + II Tubulin products.

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle terminal region of human beta I + II Tubulin. Peptide sequence: SSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit beta I + II Tubulin Antibody - BSA Free (NBP2-83947) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for beta I + II Tubulin Antibody - BSA Free

Western Blot: beta I + II Tubulin Antibody [NBP2-83947]

Western Blot: beta I + II Tubulin Antibody [NBP2-83947]

Western Blot: beta I + II Tubulin Antibody [NBP2-83947] - Host: Rabbit. Target Name: TUBB1. Sample Tissue: Human COLO205 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for beta I + II Tubulin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: beta I + II Tubulin

Tubulin is the major building block of microtubules. This intracellular, cylindrical filamentous structure is present in almost all eukaryotic cells. Microtubules function as structural and mobile elements in mitosis, intracellular transport, flagellar movement and the cytoskeleton. Except in the simplest eukaryotes, tubulin exists in all cells as a mixture of similar but not identical sets of alpha and beta tubulin polypeptides. Within either family, individual subunits diverge from each other (both within and across species) at less than 10% of the amino acid positions. The most extreme diversity is localized to the carboxy-terminal 15 residues. For beta-tubulin, five evolutionarily conserved isotype clones have been identified. These are almost totally conserved in the subunits utilized in the same cell types of different species with the exception of the hematopoietic beta tubulin which is highly divergent in sequence and which is not conserved between species. Research has been centered around the hypothesis that these beta tubulin isotypes contribute to unique functional properties. It has been reported that the different isotypes of tubulin differ from each other in their ability to polymerize into microtubules.

Alternate Names

beta tubulin 1, class VI, dJ543J19.4, tubulin beta-1 chain, tubulin, beta 1

Gene Symbol

TUBB1

Additional beta I + II Tubulin Products

Product Documents for beta I + II Tubulin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for beta I + II Tubulin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...