Skip to main content

ATP6V1C1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54902

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-54902

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

Synthetic peptides corresponding to ATP6V1C1(ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1) The peptide sequence was selected from the N terminal of ATP6V1C1. Peptide sequence ldafvegvvkkvaqymadvledskdkvqenllangvdlvtyitrfqwdma The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: C 1.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ATP6V1C1 Antibody - BSA Free

Western Blot: ATP6V1C1 Antibody [NBP1-54902]

Western Blot: ATP6V1C1 Antibody [NBP1-54902]

Western Blot: ATP6V1C1 Antibody [NBP1-54902] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for ATP6V1C1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP6V1C1

ATP6V1C1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

ATP6CH+-transporting ATPase chain C, vacuolar, ATP6Dsubunit C of vacuolar proton-ATPase V1 domain, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 42kD, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C, isoform 1, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, FLJ20057, H(+)-transporting two-sector ATPase, subunit C, vacuolar ATP synthase subunit C, vacuolar proton pump C subunit, Vacuolar proton pump subunit C 1, vacuolar proton pump, 42-kD subunit, vacuolar proton-ATPase, subunit C, VI domain, VATCH+ -ATPase C subunit, V-ATPase C subunit, V-ATPase subunit C 1, Vma5, V-type proton ATPase subunit C 1

Gene Symbol

ATP6V1C1

UniProt

Additional ATP6V1C1 Products

Product Documents for ATP6V1C1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ATP6V1C1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...