alpha Adaptin Antibody (8R8B6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16402

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16402-100ul
NBP3-16402-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8R8B6 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all alpha Adaptin Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human alpha Adaptin (O95782). MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

108 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit alpha Adaptin Antibody (8R8B6) (NBP3-16402) is a recombinant monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for alpha Adaptin Antibody (8R8B6)

Western Blot: alpha Adaptin Antibody (8R8B6) [NBP3-16402]

Western Blot: alpha Adaptin Antibody (8R8B6) [NBP3-16402]

Western Blot: alpha Adaptin Antibody (8R8B6) [NBP3-16402] - Western blot analysis of extracts of various cell lines, using alpha Adaptin Rabbit mAb (NBP3-16402) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunocytochemistry/ Immunofluorescence: alpha Adaptin Antibody (8R8B6) [NBP3-16402]

Immunocytochemistry/ Immunofluorescence: alpha Adaptin Antibody (8R8B6) [NBP3-16402]

Immunocytochemistry/Immunofluorescence: alpha Adaptin Antibody (8R8B6) [NBP3-16402] - Immunofluorescence analysis of C6 cells using alpha Adaptin Rabbit mAb (NBP3-16402) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
alpha Adaptin Antibody (8R8B6)

Immunocytochemistry/ Immunofluorescence: alpha Adaptin Antibody (8R8B6) [NBP3-16402] -

Immunocytochemistry/ Immunofluorescence: alpha Adaptin Antibody (8R8B6) [NBP3-16402] - Confocal imaging of NIH/3T3 cells using alpha Adaptin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for alpha Adaptin Antibody (8R8B6)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: alpha Adaptin

AP2A1, also known as AP-2 complex subunit alpha-1, contains a 208 kDa and a 105 kDa isoform, and is involved in protein transport, vesicle formation, and clathrin-dependent endocytosis. Current research is being conducted on the relationship between AP2A1 and a variety of diseases and disorders, including seminoma, neuronitis, Huntington's disease, malaria, myeloid leukemia, carcinoma, gout, immunodeficiency, pancreatic cancer, prostatitis, prostate carcinoma, cholesterol, breast cancer, leukemia, and pancreatitis. AP2A1 is associated with Clathrin-dependent protein traffic, CTLA4 Signaling, p38 Signaling, the EGFR1 Signaling Pathway, the Synaptic Vesicle Pathway, the Arf1 pathway, and L1CAM interactions. The protein interacts with HIP1, TOE1, SMAD9, NUMB, and GRB2.

Alternate Names

100 kDa coated vesicle protein A, Adapter-related protein complex 2 alpha-1 subunit, Adaptor protein complex AP-2 subunit alpha-1, adaptor-related protein complex 2, alpha 1 subunit, ADTAAAP2-ALPHA, Alpha1-adaptin, Alpha-adaptin A, AP-2 complex subunit alpha-1, CLAPA1adaptin, alpha A, Clathrin assembly protein complex 2 alpha-A large chain, clathrin-associated/assembly/adaptor protein, large, alpha 1, Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit

Gene Symbol

AP2A1

Additional alpha Adaptin Products

Product Documents for alpha Adaptin Antibody (8R8B6)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for alpha Adaptin Antibody (8R8B6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.