Skip to main content

ACTR1A Antibody [Alexa Fluor® 350]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38278AF350

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP3-38278AF350 has been discontinued. View all ACTR1A products.

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Alexa Fluor 350 (Excitation = 346 nm, Emission = 442 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 187-376 of human ACTR1A (NP_005727.1).

Sequence:
GRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for ACTR1A Antibody [Alexa Fluor® 350]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: ACTR1A

The actin-related protein ACTR1A, a member of the superfamily of actin-related proteins, is the major subunit of the dynactin complex, a key component of the cytoplasmic dynein motor machinery. The major components of the dynactin complex, consisting of at least ten polypeptides, include ACTR1A. ACTR1A, the most abundant subunit in the dynactin complex, is most similar to conventional actin (>50% amino acid identity). The dynactin complex has been shown to localize to multiple structures within the cell, including membrane organelles, the centrosome, spindle poles, and spindle pole microtubules during mitosis and prometaphase kinetochores. It regulates dyneinmediated vesicle movement on microtubules as well as spindle assembly and cell division. ACTR1A overexpression in cells results in aberrant spindle morphologies and cell cycle delay at prometaphase, suggesting a possible function of ACTR1A/dynactin complex in progression through the prometaphase of mitosis.

Alternate Names

Actin-RPV, alpha-centractin, ARP1 (actin-related protein 1, yeast) homolog A (centractin alpha), ARP1 actin-related protein 1 homolog A, centractin alpha (yeast), ARP1actin-RPV, centractin, Centrosome-associated actin homolog, CTRN1, FLJ52695, FLJ52800, FLJ55002

Gene Symbol

ACTR1A

Additional ACTR1A Products

Product Documents for ACTR1A Antibody [Alexa Fluor® 350]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACTR1A Antibody [Alexa Fluor® 350]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...