Skip to main content

Recombinant Human NIP GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00090527-P01

Catalog #
Availability
Size / Price
Qty
Loading...
H00090527-P01-25ug
H00090527-P01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-298 of Human NIP

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTSLFIGAAILGTPVQQLNETINYNEEFTWRLGENYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYTSAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFSMATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

58.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human NIP GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00090527-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: NIP

NIP, also referred to as Dual oxidase maturation factor 1 (DUOXA1), contains a 38 kDa, a 54 kDa, and a 33 kDa isoform, and is involved in the maturation of the DUOX complex, which produces hydrogen peroxide for thyroid hormonogenesis. Current research is being conducted on NIP and its relation to several disorders and diseases, such as aortic valve insufficiency, hypothyroidism, thyroiditis, and breast cancer. NIP has not been found to interact with other proteins, but has been linked to the processes of protein transport and neuron differentiation.

Alternate Names

Dual oxidase activator 1, dual oxidase maturation factor 1, dual oxidase maturation factor 1 delta, dual oxidase maturation factor 1 gamma, FLJ32334, homolog of Drosophila Numb-interacting protein, mol, NIPdual oxidase maturation factor 1 alpha, Numb-interacting protein, NUMBIPdual oxidase maturation factor 1 beta

Gene Symbol

DUOXA1

Additional NIP Products

Product Documents for Recombinant Human NIP GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human NIP GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...