Skip to main content

DMBT1/GP340 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38471PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-38471PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DMBT1.

Source: E. coli

Amino Acid Sequence: STPAPFLNITRPNTDYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEVQNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGAR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38471.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38471PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DMBT1

Glycoprotein-340 is member of the scavenger receptor superfamily and has been identified as a putative SP-D receptor. Gp-340 has been shown to bind SP-D in a calcium dependent manner through a protein-protein interaction. Like SP-D, gp-340 is mainly found in lung tissue and immunohistochemistry revealed high expression in alveolar macrophages (1). An identical protein is present in saliva (salivary agglutinin) and both forms are encoded by the gene DMBT1 (5).

Long Name

Deleted in Malignant Brain Tumors 1

Alternate Names

CRP-ductin, Ebnerin, GP340, Hensin, Muclin, SAG, Vomeroglandin

Gene Symbol

DMBT1

Additional DMBT1 Products

Product Documents for DMBT1/GP340 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DMBT1/GP340 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...