Casein Kinase 2 beta Antibody (9T5J10)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16264

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16264-100ul
NBP3-16264-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9T5J10 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Casein Kinase 2 beta Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 101-215 of human Casein Kinase 2 beta (CSNK2B) (P67870). YQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Casein Kinase 2 beta Antibody (9T5J10) (NBP3-16264) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Casein Kinase 2 beta Antibody (9T5J10)

Western Blot: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264]

Western Blot: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264]

Western Blot: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264] - Western blot analysis of extracts of various cell lines, using Casein Kinase 2 beta (CSNK2B) Rabbit mAb (NBP3-16264) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunocytochemistry/ Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264]

Immunocytochemistry/ Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264]

Immunocytochemistry/Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264] - Immunofluorescence analysis of U-2 OS cells using Casein Kinase 2 beta (CSNK2B) Rabbit mAb (NBP3-16264) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264]

Immunocytochemistry/ Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264]

Immunocytochemistry/Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264] - Immunofluorescence analysis of NIH-3T3 cells using Casein Kinase 2 beta (CSNK2B) Rabbit mAb (NBP3-16264) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for Casein Kinase 2 beta Antibody (9T5J10)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Casein Kinase 2 beta

Casein Kinase 2 beta encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. [provided by RefSeq]

Alternate Names

CK2B, CK2N, CSK2B, CSNK2B, G5A, Phosvitin

Gene Symbol

CSNK2B

Additional Casein Kinase 2 beta Products

Product Documents for Casein Kinase 2 beta Antibody (9T5J10)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Casein Kinase 2 beta Antibody (9T5J10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.