Skip to main content

Recombinant Human RECQ1 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00005965-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00005965-Q01-25ug
H00005965-Q01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 549-648 of Human RECQ1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: FLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQNSFRAESSQTCHSEQGDKKMEEKNSGNFQKKAANMLQQSGSKNTGAKKRKIDD

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human RECQ1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human RECQ1 GST (N-Term) Protein [H00005965-Q01]

SDS-PAGE: Recombinant Human RECQ1 GST (N-Term) Protein [H00005965-Q01]

SDS-Page: Recombinant Human RECQ1 Protein [H00005965-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00005965-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: RECQ1

The protein encoded by this gene is a member of the RecQ DNA helicase family. DNA helicases are enzymes involved in various types of DNA repair, including mismatch repair, nucleotide excision repair and direct repair. Some members of this family are associated with genetic disorders with predisposition to malignancy and chromosomal instability. The biological function of this helicase has not yet been determined. Two alternatively spliced transcripts, which encode the same isoform but differ in their 5' and 3' UTRs, have been described. [provided by RefSeq]

Alternate Names

DNA helicase, RecQ-like type 1, DNA-dependent ATPase Q1, EC 3.6.1, EC 3.6.4.12, RecQ protein-like (DNA helicase Q1-like), RecQ protein-like 1, RECQ1, RecQ1ATP-dependent DNA helicase Q1, RecQL1

Gene Symbol

RECQL

Additional RECQ1 Products

Product Documents for Recombinant Human RECQ1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human RECQ1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...