Skip to main content

TCF15 Antibody

Catalog # NBP2-83630 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-83630-0.1ml

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

1 mg/ml

Product Summary for TCF15 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human TCF15. Peptide sequence: MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TCF15 Antibody

Western Blot: TCF15 Antibody [NBP2-83630] - WB Suggested Anti-TCF15 Antibody Titration: 2.5ug/ml. Positive Control: Jurkat cell lysate

Applications for TCF15 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TCF15

The protein encoded by the TCF15 gene is found in the nucleus and may be involved in the early transcriptional regulation of patterning of the mesoderm. The encoded basic helix-loop-helix protein requires dimerization with another basic helix-loop-helix protein for efficient DNA binding. (provided by RefSeq)

Alternate Names

bHLHa40, EC2, PARAXIS, transcription factor 15, transcription factor 15 (basic helix-loop-helix)

Gene Symbol

TCF15

Product Documents for TCF15 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TCF15 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...