Skip to main content

SP4 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-83576

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-83576-0.1ml

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for SP4 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SP4. Peptide sequence: GGTALAIVTSGELDSSVTEVLGSPRIVTVAAISQDSNPATPNVSTNMEEF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SP4 Antibody

Western Blot: SP4 Antibody [NBP2-83576] - WB Suggested Anti-SP4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate
Immunohistochemistry: SP4 Antibody [NBP2-83576] - Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-SP4 antibody

Applications for SP4 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SP4

SP4 binds to GT and GC boxes promoters elements. Probable transcriptional activator

Alternate Names

MGC130008, MGC130009, Sp4 transcription factor, SPR-1HF1B, transcription factor Sp4

Gene Symbol

SP4

Additional SP4 Products

Product Documents for SP4 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SP4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...