Skip to main content

RFX8 Antibody

Catalog # NBP2-83443 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-83443-0.1ml

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for RFX8 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RFX8. Peptide sequence: AIINQGTLATSKKALASDRSGADELENNPEMKCLRNLISLLGTSTDLRVF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RFX8 Antibody

Western Blot: RFX8 Antibody [NBP2-83443] - Host: Rabbit. Target Name: RFX8. Sample Tissue: Human HT1080 Whole Cell. Antibody Dilution: 1ug/ml

Applications for RFX8 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RFX8

Alternate Names

DNA-Binding Protein RFX8, Regulatory Factor X 8, Regulatory Factor X, 8, RFX Family Member 8, Lacking RFX DNA Binding Domain, RFX Gene Family Member 8, Lacking RFX DNA Binding Domain

Gene Symbol

RFX8

Product Documents for RFX8 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RFX8 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...