MTMR11 Antibody - BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-90620
Key Product Details
Species Reactivity
Human
Applications
Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FLLALHDSVRVPDTLTFLRNTPWERGKQSGQLNSYTQVYTPGYSQPPAGNSFNLQLSVWDWDLRYSNAQILQFQNPGYDPEHCPDSWLPRPQPSFMVPG
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (84%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit MTMR11 Antibody - BSA Free (NBP1-90620) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for MTMR11 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: MTMR11 Antibody - BSA Free [NBP1-90620]
Staining of human cell line U-251 MG shows localization to centrosome.Immunohistochemistry-Paraffin: MTMR11 Antibody [NBP1-90620]
Immunohistochemistry-Paraffin: MTMR11 Antibody [NBP1-90620] - Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.Applications for MTMR11 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Immunogen affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MTMR11
Alternate Names
myotubularin related protein 11
Gene Symbol
MTMR11
Additional MTMR11 Products
Product Documents for MTMR11 Antibody - BSA Free
Product Specific Notices for MTMR11 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...