Skip to main content

MRP4/ABCC4 Antibody (1B2), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00010257-M03

Catalog #
Availability
Size / Price
Qty
Loading...
H00010257-M03

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1B2

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for MRP4/ABCC4 Antibody (1B2)

Immunogen

ABCC4 (AAH41560, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQP

Reactivity Notes

Other species not tested.

Specificity

ABCC4

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for MRP4/ABCC4 Antibody (1B2)

Western Blot: MRP4/ABCC4 Antibody (1B2) [H00010257-M03] - Analysis of ABCC4 expression in Hela S3 NE (Cat # L013V3).
Immunohistochemistry-Paraffin: MRP4/ABCC4 Antibody (1B2) [H00010257-M03] - Analysis of monoclonal antibody to ABCC4 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml
Sandwich ELISA: MRP4/ABCC4 Antibody (1B2) [H00010257-M03] - Detection limit for recombinant GST tagged ABCC4 is 0.03 ng/ml as a capture antibody.

Applications for MRP4/ABCC4 Antibody (1B2)

Application
Recommended Usage

ELISA

1:100-1:2000

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA and immunohistochemistry (paraffin).
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 2 publications using H00010257-M03 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MRP4/ABCC4

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in cellular detoxification as a pump for its substrate, organic anions. Alternative splicing results in multiple splice variants encoding different isoforms.

Long Name

Multidrug Resistance-associated Protein 4

Alternate Names

ABCC4, MOATB

Entrez Gene IDs

10257 (Human)

Gene Symbol

ABCC4

OMIM

605250 (Human)

Additional MRP4/ABCC4 Products

Product Documents for MRP4/ABCC4 Antibody (1B2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MRP4/ABCC4 Antibody (1B2)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...