Skip to main content

Novus Biologicals products are now on bio-techne.com

Better as one

LTK Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-87756

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-87756

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for LTK Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LTK. Peptide sequence: VGLSLRATPRLILLELMSGGDMKSFLRHSRPHLGQPSPLVMRDLLQLAQD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for LTK Antibody

Western Blot: LTK Antibody [NBP2-87756] - Host: Rabbit. Target Name: LTK. Sample Tissue: Human COLO205 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for LTK Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LTK

LTK is encoded by this gene is a member of the ros/insulin receptor family of tyrosine kinases. Tyrosine-specific phosphorylation of proteins is a key to the control of diverse pathways leading to cell growth and differentiation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Long Name

Leukocyte Tyrosine Kinase Receptor

Alternate Names

TYK1

Gene Symbol

LTK

Additional LTK Products

Product Documents for LTK Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for LTK Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Loading...