Skip to main content

KMT3B/NSD1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-68968

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-68968
NBP2-68968-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETSQVNLSDLKASTLVHKPQSDFT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit KMT3B/NSD1 Antibody - BSA Free (NBP2-68968) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for KMT3B/NSD1 Antibody - BSA Free

Immunohistochemistry: KMT3B/NSD1 Antibody [NBP2-68968]

Immunohistochemistry: KMT3B/NSD1 Antibody [NBP2-68968]

Immunohistochemistry: KMT3B/NSD1 Antibody [NBP2-68968] - Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts and Leydig cells.

Applications for KMT3B/NSD1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KMT3B/NSD1

KMT3B / NSD1 encodes a protein containing a SET domain, 2 LXXLL motifs, 3 nuclear translocation signals (NLSs), 4 plant homeodomain (PHD) finger regions, and a proline-rich region. The encoded protein enhances androgen receptor (AR) transactivation, and this enhancement can be increased further in the presence of other androgen receptor associated coregulators. This protein may act as a nucleus-localized, basic transcriptional factor and also as a bifunctional transcriptional regulator. Mutations of this gene have been associated with Sotos syndrome and Weaver syndrome. One version of childhood acute myeloid leukemia is the result of a cryptic translocation with the breakpoints occurring within nuclear receptor-binding Su-var, enhancer of zeste, and trithorac domain protein 1 on chromosome 5 and nucleoporin, 98-kd on chromosome 11. Two transcript variants encoding distinct isoforms have been identified for this gene.

Alternate Names

Androgen receptor coactivator 267 kDa protein, Androgen receptor-associated protein of 267 kDa, ARA267STO, DKFZp666C163, EC 2.1.1.43, FLJ10684, FLJ22263, FLJ44628, H3 lysine-36 and H4 lysine-20 specific, KMT3BSotos syndrome, Lysine N-methyltransferase 3B, NR-binding SET domain-containing protein, nuclear receptor binding SET domain protein 1

Gene Symbol

NSD1

Additional KMT3B/NSD1 Products

Product Documents for KMT3B/NSD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for KMT3B/NSD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...