Skip to main content

B4GALNT3 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-84488

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-84488-0.1ml

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for B4GALNT3 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human B4GALNT3. Peptide sequence: NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for B4GALNT3 Antibody

Western Blot: B4GALNT3 Antibody [NBP2-84488] - WB Suggested Anti-B4GALNT3 Antibody Titration: 0.2-1 ug/ml. Positive Control: Hela cell lysate

Applications for B4GALNT3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: B4GALNT3

Long Name

Beta-1,4-N-Acetyl-Galactosaminyltransferase 3

Alternate Names

B4GalNAcT3, Beta4GalNAcT3, NGalNAc-T2

Gene Symbol

B4GALNT3

Additional B4GALNT3 Products

Product Documents for B4GALNT3 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for B4GALNT3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...