Skip to main content

Novus Biologicals products are now on bio-techne.com

Better as one

Aminopeptidase N/CD13 Antibody

Catalog # NBP2-33855 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33855

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Simple Western, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Aminopeptidase N/CD13 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aminopeptidase N/CD13 Antibody

Western Blot: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Analysis in human small intestine tissue.
Immunocytochemistry/Immunofluorescence: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Staining of human cell line BJ shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Staining of human small intestine shows strong membranous positivity in glandular cells.

Applications for Aminopeptidase N/CD13 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Simple Western

1:25

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aminopeptidase N/CD13

Alanine aminopeptidase (CD13) is expressed on the majority of peripheral blood monocytes and granulocytes. CD13 is also expressed by the majority of acute myeloid leukemias, chronic myeloid leukemias in myeloid blast crisis, a smaller percentage of lymphoid leukemias and myeloid cell lines. CD13 is also found in several types of non hematopoietic cells such as fibroblasts and endothelial cells and in a soluble form in blood plasma. CD13 is not expressed on B cells, T cells, platelets or erythrocytes. In the mouse, CD13 is a non-covalently linked homodimer of approximately 150kD subunits expressed by a variety of cells including monocytes, macrophages, dendritic cell and veiled cells. CD13 plays a role in biologically active peptide metabolism, in the control of growth and differentiation, in phagocytosis and in bactericidal/tumoricidal activities. CD13 also serves as a receptor for human coronaviruses.

CD13 is commonly used as a biomarker to detect damage to the kidneys, and that may be used to help diagnose certain kidney disorders. Therefore, CD13 antibodies are useful tools for cancer and renal disorder research.

Alternate Names

Aminopeptidase M, ANPEP, APN, CD13, gp150, PEPN

Gene Symbol

ANPEP

UniProt

Additional Aminopeptidase N/CD13 Products

Product Documents for Aminopeptidase N/CD13 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Aminopeptidase N/CD13 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...