Skip to main content

ACSL5 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-59645

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-59645

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Simple Western, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

Product Summary for ACSL5 Antibody

Immunogen

Synthetic peptides corresponding to ACSL5(acyl-CoA synthetase long-chain family member 5) The peptide sequence was selected from the C terminal of ACSL5. Peptide sequence ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACSL5 Antibody

Western Blot: ACSL5 Antibody [NBP1-59645] - Detection of ACSL5 in rat lysate. Image provided by Dr. Eric Klett of UNC School of Medicine.
Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645] - IHC analysis of human skeletal muscle tissue. Antibody concentration of 4 - 8ug/mL.
Western Blot: ACSL5 Antibody [NBP1-59645] - Human placenta tissue lysate. Antibody at a concentration of 1 ug/mL.

Applications for ACSL5 Antibody

Application
Recommended Usage

Immunohistochemistry

1:10 - 1:500

Immunohistochemistry-Paraffin

4 - 8 ug/mL

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Reviewed Applications

Read 2 reviews rated 4.5 using NBP1-59645 in the following applications:

Published Applications

Read 2 publications using NBP1-59645 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACSL5

ASCL5 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

Alternate Names

ACS2, ACS5FACL5 for fatty acid coenzyme A ligase 5, acyl-CoA synthetase long-chain family member 5, EC 6.2.1, EC 6.2.1.3, FACL5fatty acid coenzyme A ligase 5, fatty-acid-Coenzyme A ligase, long-chain 5, LACS 5, Long-chain acyl-CoA synthetase 5, long-chain fatty acid coenzyme A ligase 5, long-chain-fatty-acid--CoA ligase 5

Gene Symbol

ACSL5

UniProt

Additional ACSL5 Products

Product Documents for ACSL5 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACSL5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...