Skip to main content

ACOT1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-82574

Catalog #
Size / Price

Key Product Details

Species Reactivity




Western Blot



Antibody Source

Polyclonal Rabbit


0.5 mg/ml

Product Summary for ACOT1 Antibody


The immunogen is a synthetic peptide directed towards the middle region of human ACOT1. Peptide sequence: ESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKPQIICYPETGHYIEP The peptide sequence for this immunogen was taken from within the described region.





Scientific Data Images for ACOT1 Antibody

Western Blot: ACOT1 Antibody [NBP2-82574] - Host: Rabbit. Target Name: ACOT1. Sample Tissue: Human A549 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for ACOT1 Antibody

Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage


Affinity purified


PBS, 2% Sucrose


0.09% Sodium Azide


0.5 mg/ml


The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACOT1

Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fattyacid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acidsand CoASH. Active towards fatty acyl-CoA with chain-lengths of C12-C16

Alternate Names

ACH2, acyl-CoA thioesterase 1Long chain acyl-CoA thioester hydrolase, acyl-coenzyme A thioesterase 1, CTE1, CTE-1, CTE-I, CTE-Ib, EC, Inducible cytosolic acyl-coenzyme A thioester hydrolase, LACH2, Long chain acyl-CoA hydrolase

Gene Symbol


Additional ACOT1 Products

Product Documents for ACOT1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ACOT1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
