Skip to main content

ABTB2 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-55198

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-55198-25ul
NBP2-55198

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABTB2 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MVDTRISVRIHEYAAISLTACMENLVEEIRARVMASHSPDGGGAGGGEVSAEALEMVINNDAELWGVLQPYEH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABTB2 Antibody

Immunocytochemistry/Immunofluorescence: ABTB2 Antibody [NBP2-55198] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Applications for ABTB2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABTB2

ABTB2 may be involved in the initiation of hepatocyte growth

Alternate Names

ankyrin repeat and BTB (POZ) domain containing 2, ankyrin repeat and BTB/POZ domain-containing protein 2, DKFZP586C1619

Gene Symbol

ABTB2

Additional ABTB2 Products

Product Documents for ABTB2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABTB2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...