Skip to main content

ABHD13 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-88978

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-88978

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABHD13 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ABHD13 Antibody

Western Blot: ABHD13 Antibody [NBP1-88978] - Analysis in control (vector only transfected HEK293T lysate) and ABHD13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ABHD13 Antibody [NBP1-88978] - Staining of human gall bladder shows moderate membranous positivity in glandular cells.

Applications for ABHD13 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABHD13

Alternate Names

abhydrolase domain containing 13, abhydrolase domain-containing protein 13, bA153I24.2, BEM46L1, C13orf6, chromosome 13 open reading frame 6, EC 3.-, FLJ14906, MGC27058, RP11-153I24.2

Entrez Gene IDs

84945 (Human)

Gene Symbol

ABHD13

UniProt

Additional ABHD13 Products

Product Documents for ABHD13 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABHD13 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...