Skip to main content

ABCC11 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-38192

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-38192
NBP2-38192-25ul

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABCC11 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RIGLETEAQFTAVERILQYMKMCVSEAPLHMEGTSCPQGWPQHGEIIFQDYHMKYRDNTPTVLHGINLTIRGHEVVGIV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ABCC11 Antibody

Immunohistochemistry: ABCC11 Antibody [NBP2-38192] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes .

Applications for ABCC11 Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCC11

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This ABC full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. The product of this gene participates in physiological processes involving bile acids, conjugated steroids, and cyclic nucleotides. In addition, a SNP in this gene is responsible for determination of human earwax type. This gene and family member ABCC12 are determined to be derived by duplication and are both localized to chromosome 16q12.1. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]

Alternate Names

ATP-binding cassette protein C11, ATP-binding cassette transporter MRP8, ATP-binding cassette transporter sub-family C member 11, ATP-binding cassette, sub-family C (CFTR/MRP), member 11, EWWD, MRP8ATP-binding cassette sub-family C member 11, Multidrug resistance-associated protein 8, multi-resistance protein 8, WW

Gene Symbol

ABCC11

UniProt

Additional ABCC11 Products

Product Documents for ABCC11 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCC11 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...