Skip to main content

ABCC11 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-59810

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-59810

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

Product Summary for ABCC11 Antibody

Immunogen

Synthetic peptides corresponding to ABCC11(ATP-binding cassette, sub-family C (CFTR/MRP), member 11) The peptide sequence was selected from the middle region of ABCC11. Peptide sequence NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ABCC11 Antibody

Western Blot: ABCC11 Antibody [NBP1-59810] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Applications for ABCC11 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 1 publication using NBP1-59810 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCC11

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This ABC full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. The product of this gene participates in physiological processes involving bile acids, conjugated steroids, and cyclic nucleotides. In addition, a SNP in this gene is responsible for determination of human earwax type. This gene and family member ABCC12 are determined to be derived by duplication and are both localized to chromosome 16q12.1. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]

Alternate Names

ATP-binding cassette protein C11, ATP-binding cassette transporter MRP8, ATP-binding cassette transporter sub-family C member 11, ATP-binding cassette, sub-family C (CFTR/MRP), member 11, EWWD, MRP8ATP-binding cassette sub-family C member 11, Multidrug resistance-associated protein 8, multi-resistance protein 8, WW

Gene Symbol

ABCC11

UniProt

Additional ABCC11 Products

Product Documents for ABCC11 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCC11 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...