Skip to main content

ABCA6 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-57372

Catalog #
Size / Price

Key Product Details

Species Reactivity




Immunocytochemistry/ Immunofluorescence



Antibody Source

Polyclonal Rabbit IgG


Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABCA6 Antibody


This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LYFDKILPYGDERHYSPLFFLNSSSCFQHQRTNAKVIEKEIDAEHPSDDYF







Scientific Data Images for ABCA6 Antibody

Immunocytochemistry/Immunofluorescence: ABCA6 Antibody [NBP2-57372] - Staining of human cell line RT4 shows localization to nucleoplasm.

Applications for ABCA6 Antibody

Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage


Affinity purified


PBS (pH 7.2) and 40% Glycerol


0.02% Sodium Azide


Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.


The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCA6

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24 and may play a role in macrophage lipid homeostasis.

Alternate Names

ABC transporter ABCA6, ATP-binding cassette A6, ATP-binding cassette sub-family A member 6, ATP-binding cassette, sub-family A (ABC1), member 6, EC, EC 3.6.3, EC, EST155051, FLJ43498

Gene Symbol


Additional ABCA6 Products

Product Documents for ABCA6 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCA6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
