Skip to main content

AASD-PPT Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-54977

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-54977

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

Product Summary for AASD-PPT Antibody

Immunogen

Synthetic peptides corresponding to AASD-PPT. The peptide sequence was selected from the C terminal of AASDHPPT. Peptide sequence SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AASD-PPT Antibody

Western Blot: AASD-PPT Antibody [NBP1-54977] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for AASD-PPT Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AASD-PPT

AASDHPPT is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.

Alternate Names

4'-phosphopantetheinyl transferase, AASD-PPTDKFZp566E2346, Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase, aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, CGI-80, EC 2.7.8, EC 2.7.8.-, L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, LYS2, LYS5, LYS5 ortholog

Gene Symbol

AASDHPPT

UniProt

Additional AASD-PPT Products

Product Documents for AASD-PPT Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AASD-PPT Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...