Skip to main content

15-Lipoxygenase 2 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-55145

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-55145

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

Product Summary for 15-Lipoxygenase 2 Antibody

Immunogen

Synthetic peptides corresponding to ALOX15B(arachidonate 15-lipoxygenase, type B) The peptide sequence was selected from the N terminal of ALOX15B (NP_001034220), Peptide sequence MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for 15-Lipoxygenase 2 Antibody

Western Blot: 15-Lipoxygenase 2 Antibody [NBP1-55145] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for 15-Lipoxygenase 2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 15-Lipoxygenase 2

ALOX15B is a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively.This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

15-lipoxygenase 2, 15-LOX-B, arachidonate 15-lipoxygenase 2, arachidonate 15-lipoxygenase B, Arachidonate 15-lipoxygenase type II, arachidonate 15-lipoxygenase, second type, arachidonate 15-lipoxygenase, type B, arachidonate omega(6) lipoxygenase, EC 1.13.11, EC 1.13.11.33,15-LOX-215S-lipoxygenase

Entrez Gene IDs

247 (Human)

Gene Symbol

ALOX15B

UniProt

Additional 15-Lipoxygenase 2 Products

Product Documents for 15-Lipoxygenase 2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for 15-Lipoxygenase 2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...