Peptide YY (3-36) (porcine)

Name: Peptide YY (3-36) (porcine)
Brand: Tocris Bioscience
SKU: 1618

Tocris Bioscience, part of Bio-Techne | Catalog # 1618

Citations (10)

COA / SDS

Selective NPY Y2 receptor agonist

Key Product Details

Description:	Selective NPY Y₂ receptor agonist
Alternative Names:	PYY 3-36
Purity:	≥95% (HPLC)
Molecular Weight:	3980.4

View Full Technical Details for Peptide YY (3-36) (porcine)

Technical Data
Citations

Biological Activity for Peptide YY (3-36) (porcine)

Peptide YY (3-36) (porcine) is a Y₂ selective agonist. IC₅₀ values are 0.11 and 1050 nM for inhibition of ¹²⁵I-PYY binding to Y₂ and Y₁ receptors respectively. Inhibits food intake and reduces weight gain in vivo. Brain penetrant.

Technical Data for Peptide YY (3-36) (porcine)

M. Wt	3980.4
Formula	C₁₇₆H₂₇₂N₅₂O₅₄
Single Letter Sequence	AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY (Modifications: Tyr-34 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	126339-09-1
PubChem ID	90479816
InChi Key	AIYOBVCUSVSXOL-NYGOYQSZSA-N
Smiles	[H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Peptide YY (3-36) (porcine)

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Peptide YY (3-36) (porcine)

References are publications that support the biological activity of the product.

Keire Primary structures of PYY, [Pro³⁴]PYY and PYY-(3-36) confer different conformations and receptor selectivity. Am.J.Physiol.Gastrointest.Liver Physiol. 2000 PMID: 10898754
Nonaka Characterization of blood-brain barrier permeability to PYY_3-36 in the mouse. J.Pharmacol.Exp.Ther. 2003 PMID: 12750431
Batterham Gut hormone PYY_3-36 physiologically inhibits food intake. Nature 2002 PMID: 12167864