Margatoxin

Name: Margatoxin
Brand: Tocris Bioscience
SKU: 3563
Rating: 5 (1 reviews)

Tocris Bioscience, part of Bio-Techne | Catalog # 3563

(1)

Citations (2)

COA / SDS

Potent KV1.3 channel blocker

Discontinued Product

3563 has been discontinued. View all Voltage-gated Potassium Channel Blockers products.

Key Product Details

Description:	Potent K_V1.3 channel blocker
Alternative Names:	MgTX
Purity:	≥95% (HPLC)
Molecular Weight:	4178.96

View Full Technical Details for Margatoxin

Technical Data
Citations / Reviews (1)

Biological Activity for Margatoxin

Margatoxin is a potent K_V1.3 channel blocker (IC₅₀ = 36 pM). Displays no effect at calcium-activated channels. Reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.

Technical Data for Margatoxin

M. Wt	4178.96
Formula	C₁₇₈H₂₈₆N₅₂O₅₀S₇
Single Letter Sequence	TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Modifications: Disulfide bridges: 7-29, 13-34, 17-36)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	145808-47-5
PubChem ID	121596045
InChi Key	OVJBOPBBHWOWJI-FYNXUGHNSA-N
Smiles	[H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CO)NC(=O)[C@@H](NC1=O)[C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Margatoxin

References are publications that support the biological activity of the product.

Erdogan Margatoxin inhibits VEGF-induced hyperpolarization, proliferation and nitric oxide production of human endothelial cells. J.Vasc.Res. 2005 PMID: 16043967
Garcia-Calvo Purification, characterization, and biosynthesis of Margatoxin, a component of Centruroides margaritatus venom that selectively inhibits voltage-dependent potassium channels. J.Biol.Chem. 1993 PMID: 8360176

Margatoxin

Tocris Bioscience, part of Bio-Techne | Catalog # 3563

Key Product Details

Biological Activity for Margatoxin

Technical Data for Margatoxin

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for Margatoxin

Product Documents for Margatoxin

COA

Certificate of Analysis

SDS

CONTACT INFORMATION

Stay Connected