Jingzhaotoxin III

Name: Jingzhaotoxin III
Brand: Tocris Bioscience
SKU: 4913

Tocris Bioscience, part of Bio-Techne | Catalog # 4913

Citations (1)

COA / SDS

Selective NaV1.5 channel blocker

Key Product Details

Description:	Selective Na_V1.5 channel blocker
Purity:	≥95% (HPLC)
Molecular Weight:	3919.5

View Full Technical Details for Jingzhaotoxin III

Technical Data
Citations

Biological Activity for Jingzhaotoxin III

Jingzhaotoxin III is a selective blocker of Na_V1.5 channels (IC₅₀ = 348 nM); displays no effect on other isoforms, including Na_V1.2, Na_V1.4, Na_V1.6 and Na_V1.7. Thought to inhibit sodium channel activation by binding to the Na_V1.5 S3-S4 linker of domain II. Selectively inhibits the activation of cardiac sodium channels, but has no effect on sodium channels in dorsal root ganglion neurons.

Technical Data for Jingzhaotoxin III

M. Wt	3919.5
Formula	C₁₇₄H₂₄₁N₄₇O₄₆S₆
Single Letter Sequence	DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP (Modifications: Disulfide bridges: 4-19, 11-24, 18-31)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	925463-91-8
PubChem ID	90488988
InChi Key	OKELXNUZHJLTAQ-UHFFFAOYSA-N
Smiles	[H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)CNC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)CNC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](C)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)CNC(=O)[C@H](CCCCN)NC2=O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Jingzhaotoxin III

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Jingzhaotoxin III

References are publications that support the biological activity of the product.

Rong Molecular basis of the tarantula toxin jingzhaotoxin-III (β-TRTX-Cj1α) interacting with voltage sensors in sodium channel subtype Nav1.5. FASEB J. 2011 PMID: 21665957
Xiao Jingzhaotoxin-III, a novel spider toxin inhibiting activation of sodium channel in rat cardiac myocytes. J.Biol.Chem. 2004 PMID: 15084603