Iberiotoxin

Name: Iberiotoxin
Brand: Tocris Bioscience
SKU: 1086
Rating: 5 (1 reviews)

Tocris Bioscience, part of Bio-Techne | Catalog # 1086

(1)

Citations (172)

COA / SDS

KCa (BK) channel blocker

Key Product Details

Description:	K_Ca (BK) channel blocker
Purity:	≥95% (HPLC)
Molecular Weight:	4230

View Full Technical Details for Iberiotoxin

Technical Data
Citations / Reviews (1)

Biological Activity for Iberiotoxin

Iberiotoxin is a selective blocker of the big conductance Ca²⁺-activated K⁺ channel.

Technical Data for Iberiotoxin

M. Wt	4230
Formula	C₁₇₉H₂₇₄N₅₀O₅₅S₇
Single Letter Sequence	XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ (Modifications: X-1 = pGlu, Disulfide bridges: 7-28, 13-33, 17-35)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	129203-60-7
PubChem ID	16132435
InChi Key	VDNVVLOBNHIMQA-UHFFFAOYSA-N
Smiles	[H]N1[C@@H](CCC1=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CO)NC1=O)C(C)C)C(=O)N[C@@H](CC1=CNC4=C1C=CC=C4)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O)C(C)C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Iberiotoxin

Solubility

Soluble to 0.7mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Iberiotoxin

References are publications that support the biological activity of the product.

Suarez-Kurtz Effects of charybdotoxin and iberiotoxin on the spontaneous motility and tonus of different guinea-pig smooth muscle tissues. J.Pharmacol.Exp.Ther. 1991 PMID: 1717682
Galvez Purification and characterization of a unique, potent, peptidyl probe for the high conductance calcium-activated potassium channel from venom of the scorpion Buthus tamulus. J.Biol.Chem. 1990 PMID: 1694175