Calcitonin (human)

Name: Calcitonin (human)
Brand: Tocris Bioscience
SKU: 6031

Tocris Bioscience, part of Bio-Techne | Catalog # 6031

COA / SDS

Endogenous calcitonin agonist; inhibits bone resorption

Key Product Details

Description:	Endogenous calcitonin agonist; inhibits bone resorption
Purity:	≥95% (HPLC)
Molecular Weight:	3417.87

View Full Technical Details for Calcitonin (human)

Technical Data
Citations

Biological Activity for Calcitonin (human)

Calcitonin (human) is an endogenous calcitonin receptor agonist. Lowers systemic blood calcium levels and inhibits bone resorption.

Technical Data for Calcitonin (human)

M. Wt	3417.87
Formula	C₁₅₁H₂₂₆N₄₀O₄₅S₃
Single Letter Sequence	CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP (Modifications: Pro-32 = C-terminal amide, Disulfide bridge: 1-7)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	21215-62-3
PubChem ID	122705992
InChi Key	LCQDOKHKNORMTQ-JKQNMTHDSA-N
Smiles	[H]N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)CNC1=O)[C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Calcitonin (human)

Solubility

Soluble to 2mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Calcitonin (human)

References are publications that support the biological activity of the product.

Bower and Hay Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development. Br.J.Pharmacol. 2016 PMID: 27061187
Lee Calcitonin and amylin receptor peptide interaction mechanisms. J.Biol.Chem. 2016 PMID: 27474777
Foster Calcitonin. A review of experimental and clinical investigations. Postgrad.Med.J. 1968 PMID: 4871775