Skip to main content

ZFP106 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13543PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-13543PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZFP106.

Source: E. coli

Amino Acid Sequence: RSGWHKGVAGGSSTWFHNHSNSGGGWLSNSGAVDWNHNGTGRNSSWLSEGTGGFSSWHMNNSNGNWKSSVRSTNNWNYSGPGDKFQPGRNRNSNCQMEDMTMLWNKKSNKSNKYSHDRYNWQRQENDKLGTVATYRGPSEGFTSD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13543.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-13543PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ZFP106

Zinc finger protein homolog 106 (ZFP106) is a C2H2-type zinc finger protein that also contains 2 WD repeats. ZFP106 is highly expressed in striated muscle, brown fat, and developing brain and is regulated by myogenin and nuclear respiratory factor-1 (NRF-1). ZFP106 localizes to the nucleus in association with nucleolar transcriptional machinery. The WD40 repeat in ZFP106 appears to facilitate targeting of ZFP106 to the nucleolus and to mediate the interaction between ZFP106 and testis-specific gene 118 (TSF118). A two-hybrid screen has identified testis-specific Y-encoded-like protein (TSPYL) as a ZFP106 interacting protein. These data suggest an important role for ZFP106 in testis development.

Alternate Names

DKFZp451A239, FLJ34610, SH3BP3, SH3-domain binding protein 3, zfp-106, zinc finger protein 106 homolog, zinc finger protein 106 homolog (mouse), Zinc finger protein 474, ZNF474FLJ45841

Gene Symbol

ZFP106

Additional ZFP106 Products

Product Documents for ZFP106 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ZFP106 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...